PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe4G263200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 376aa    MW: 42533.4 Da    PI: 5.9123
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe4G263200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.5e-171461148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++l d++++ G g+W+t ++  g+ R++k+c++rw +yl
  Aqcoe4G263200.1.p 14 KGPWTPDEDQKLMDYIQKNGHGSWRTLPKNAGLQRCGKSCRLRWTNYL 61
                       79********************************************97 PP

2Myb_DNA-binding53.45.8e-1767111147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Aqcoe4G263200.1.p  67 RGRFSFEEEETIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                        89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.563961IPR017930Myb domain
SuperFamilySSF466891.31E-3011108IPR009057Homeodomain-like
SMARTSM007175.9E-121363IPR001005SANT/Myb domain
PfamPF002491.7E-151461IPR001005SANT/Myb domain
CDDcd001673.48E-101661No hitNo description
PROSITE profilePS5129425.13762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-2665116IPR009057Homeodomain-like
SMARTSM007174.8E-1666114IPR001005SANT/Myb domain
PfamPF002492.3E-1567111IPR001005SANT/Myb domain
CDDcd001675.78E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPD EDQKLMDYIQ KNGHGSWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRF DLLDLSSILG SQLYNSSQLN VSRLLGIHQP VVNPELIRLA TSLLSSHREN  180
SNNLLLQNLQ ENQLRNPDFQ QQNQFQSFQP NQLQNSIQEV HPASTTTTTT ASAVPCDTFF  240
NEAQVMQANT MEQFQSNPMN FNCQGSQQNV WQDNVMVSNL SEDFVPVSIQ QNYGLCGSSS  300
QPSFEDLVSE NSNFQSNISN QNFSFTSVLS TPSSSPTPLT TSGSTYISTE DERDSYCSNM  360
LKFEIPDILD MNDFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-30121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010277911.11e-177PREDICTED: transcription factor MYB39
TrEMBLV4U8Y81e-159V4U8Y8_9R
STRINGPOPTR_0004s03310.11e-155(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-106MYB-like 102